Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sumo1 Rabbit Polyclonal Antibody (FITC)

Sumo1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PI, SE, Ubl, GMP1, PIC1, SMT3, Ubl1, SMTP3, Smt3C, SMT3H3, SUMO-1, SENTRIN

UniProt

P63166

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033486

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IDO2 Antibody (OTI11B2) [DyLight 350]
NBP2-72454UV 0.1 mL

Mouse Monoclonal IDO2 Antibody (OTI11B2) [DyLight 350]

Sign In for Pricing
View Details
Mouse Sestd1 Pre-designed siRNA Set B
SI112758B 1 Each

Mouse Sestd1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CCDC124 Rabbit Polyclonal Antibody (Cy5.5)
orb1038404 100 µL

CCDC124 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
MPV17L siRNA Oligos set (Human)
30377171 3x 5 nmol

MPV17L siRNA Oligos set (Human)

Sign In for Pricing
View Details
Human GAS6 ELISA Kit (Ready to Use)
orb550951-01 48 Tests

Human GAS6 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human GAS6 ELISA Kit (Ready to Use)
orb550951-02 96 Tests

Human GAS6 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details