Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YWHAB Rabbit Polyclonal Antibody (HRP)

YWHAB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HS1, GW128, YWHAA, KCIP-1, HEL-S-1

UniProt

P31946

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human YWHAB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_003395

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF 121 Recombinant Protein
orb1227837 0.02 mg

VEGF 121 Recombinant Protein

Sign In for Pricing
View Details
Serine/Threonine-Protein Kinase mTOR / FRAP (mTOR) Antibody
abx433600 200 µL

Serine/Threonine-Protein Kinase mTOR / FRAP (mTOR) Antibody

Sign In for Pricing
View Details
Olfr895 ORF Vector (Mouse) (pORF)
ORF053002 1.0 µg DNA

Olfr895 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Prolactin (LTH, Luteotropic Hormone, Lactogenic Hormone) (PE) discontinued
P9009-30-PE 100 µL

Prolactin (LTH, Luteotropic Hormone, Lactogenic Hormone) (PE) discontinued

Sign In for Pricing
View Details
pFastBac-M30a Plasmid
PVT37647 2 µg

pFastBac-M30a Plasmid

Sign In for Pricing
View Details
Mmel1 Rat shRNA Plasmid (Locus ID 313755)
TL706543 1 Kit

Mmel1 Rat shRNA Plasmid (Locus ID 313755)

Sign In for Pricing
View Details