Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YWHAE Rabbit Polyclonal Antibody (Biotin)

YWHAE Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MDS, HEL2, MDCR, KCIP-1, 14-3-3E

UniProt

P62258

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDEN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006752

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Menin Rabbit Polyclonal Antibody (Biotin)
orb457959 100 µL

Menin Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
ZFP36, ID (G0/G1 switch regulatory protein 24, Growth factor-inducible nuclear protein NUP475, Protein TIS11A, TIS11, Zinc finger protein 36 homolog, Zfp-36, Tristetraproline, TTP, ZFP36, G0S24, RNF162A, TIS11A) (MaxLight 550) discontinued
Z0737-37B-ML550 100 µL

ZFP36, ID (G0/G1 switch regulatory protein 24, Growth factor-inducible nuclear protein NUP475, Protein TIS11A, TIS11, Zinc finger protein 36 homolog, Zfp-36, Tristetraproline, TTP, ZFP36, G0S24, RNF162A, TIS11A) (MaxLight 550) discontinued

Sign In for Pricing
View Details
BIF Antibody
3704-30T 30 µg

BIF Antibody

Sign In for Pricing
View Details
Recombinant Human CD233/SLC4A1 Protein, N-His
orb2836765-01 20 µg

Recombinant Human CD233/SLC4A1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD233/SLC4A1 Protein, N-His
orb2836765-02 50 µg

Recombinant Human CD233/SLC4A1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD233/SLC4A1 Protein, N-His
orb2836765-03 100 µg

Recombinant Human CD233/SLC4A1 Protein, N-His

Sign In for Pricing
View Details