Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccl20 Rabbit Polyclonal Antibody (Biotin)

Ccl20 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ST38, Scya20

UniProt

P97884

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQI

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_062106

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana Probable WRKY transcription factor 2 (WRKY2), partial
CSB-YP875437DOA-01 20 µg

Recombinant Arabidopsis thaliana Probable WRKY transcription factor 2 (WRKY2), partial

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 2 (WRKY2), partial
CSB-YP875437DOA-02 100 µg

Recombinant Arabidopsis thaliana Probable WRKY transcription factor 2 (WRKY2), partial

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 2 (WRKY2), partial
CSB-YP875437DOA-03 1 mg

Recombinant Arabidopsis thaliana Probable WRKY transcription factor 2 (WRKY2), partial

Sign In for Pricing
View Details
Recombinant Aromatoleum aromaticum UDP-3-O-acylglucosamine N-acyltransferase (lpxD)
MBS1386910-01 0.02 mg (E-Coli)

Recombinant Aromatoleum aromaticum UDP-3-O-acylglucosamine N-acyltransferase (lpxD)

Sign In for Pricing
View Details
Recombinant Aromatoleum aromaticum UDP-3-O-acylglucosamine N-acyltransferase (lpxD)
MBS1386910-02 0.02 mg (Yeast)

Recombinant Aromatoleum aromaticum UDP-3-O-acylglucosamine N-acyltransferase (lpxD)

Sign In for Pricing
View Details
Recombinant Aromatoleum aromaticum UDP-3-O-acylglucosamine N-acyltransferase (lpxD)
MBS1386910-03 0.1 mg (E-Coli)

Recombinant Aromatoleum aromaticum UDP-3-O-acylglucosamine N-acyltransferase (lpxD)

Sign In for Pricing
View Details