Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CX3CL1 Rabbit Polyclonal Antibody (HRP)

CX3CL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NTN, NTT, CXC3, CXC3C, SCYD1, ABCD-3, C3Xkine, fractalkine, neurotactin

UniProt

P78423

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CX3CL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQRVWGQ

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001291321.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant TATA Binding Protein (TBP)
TRV-0054254-01 10 µg

Recombinant TATA Binding Protein (TBP)

Sign In for Pricing
View Details
Recombinant TATA Binding Protein (TBP)
TRV-0054254-02 50 µg

Recombinant TATA Binding Protein (TBP)

Sign In for Pricing
View Details
Recombinant TATA Binding Protein (TBP)
TRV-0054254-03 100 µg

Recombinant TATA Binding Protein (TBP)

Sign In for Pricing
View Details
Recombinant TATA Binding Protein (TBP)
TRV-0054254-04 200 µg

Recombinant TATA Binding Protein (TBP)

Sign In for Pricing
View Details
Recombinant TATA Binding Protein (TBP)
TRV-0054254-05 500 µg

Recombinant TATA Binding Protein (TBP)

Sign In for Pricing
View Details
Recombinant TATA Binding Protein (TBP)
TRV-0054254-06 1 mg

Recombinant TATA Binding Protein (TBP)

Sign In for Pricing
View Details