Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL23 Rabbit Polyclonal Antibody (Biotin)

CCL23 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CKb8, MIP3, Ckb-8, MIP-3, MPIF-1, SCYA23, Ckb-8-1, hmrp-2a, CK-BETA-8

UniProt

P55773

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CCL23

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SADCCISYTPRSIPCSLLESYFETNSECSKPGVIFLTKKGRRFCANPSDK

Field of Research

Immunology & Inflammation

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_665905

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SA2 Rabbit pAb, AP conjugated
orb2858440 100 µL

SA2 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (MaxLight 490)
247050-ML490 100 µL

HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (MaxLight 490)

Sign In for Pricing
View Details
SCA23 3'UTR GFP Stable Cell Line
TU072631 1.0 mL

SCA23 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
EMID2, ID (EMID2, COL26A1, EMU2, Collagen alpha-1 (XXVI) chain, EMI domain-containing protein 2, Emilin and multimerin domain-containing protein 2) (Biotin) discontinued
035061-Biotin 200 µL

EMID2, ID (EMID2, COL26A1, EMU2, Collagen alpha-1 (XXVI) chain, EMI domain-containing protein 2, Emilin and multimerin domain-containing protein 2) (Biotin) discontinued

Sign In for Pricing
View Details
ZN165 Rabbit Polyclonal Antibody
JOT-AP13736-01 20 µL

ZN165 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZN165 Rabbit Polyclonal Antibody
JOT-AP13736-02 50 μL

ZN165 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details