Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccl11 Rabbit Polyclonal Antibody (Biotin)

Ccl11 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Eot, Scya, Scya11, eotaxin

UniProt

P48298

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTP

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035460

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-22 (Interleukin 22) ELISA Kit
E-EL-M2446-01 24 Tests

Mouse IL-22 (Interleukin 22) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-22 (Interleukin 22) ELISA Kit
E-EL-M2446-02 48 Tests

Mouse IL-22 (Interleukin 22) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-22 (Interleukin 22) ELISA Kit
E-EL-M2446-03 96 Tests

Mouse IL-22 (Interleukin 22) ELISA Kit

Sign In for Pricing
View Details
ADP-ribosylation Factor Like protein 2-binding protein (ARL2BP) Human ELISA Kit
B3111 96 Tests

ADP-ribosylation Factor Like protein 2-binding protein (ARL2BP) Human ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Cyb5d1 shRNA (UAS) - Lentiviral mouse Cyb5d1 shRNA (UAS, GFP) (100)
GTR15222225 1 Vial

Lentiviral mouse Cyb5d1 shRNA (UAS) - Lentiviral mouse Cyb5d1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
TSPAN7 Antibody, Biotin conjugated
CSB-PA025165LD01HU-01 50 µg

TSPAN7 Antibody, Biotin conjugated

Sign In for Pricing
View Details