Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bcl11a Rabbit Polyclonal Antibody (FITC)

Bcl11a Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ev, CTI, Evi, Evi9, Ctip1, Evi9a, Evi9b, Evi9c, BCL-11A, mKIAA1809, 2810047E18Rik, D930021L15Rik

UniProt

Q5STS7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Bcl11a

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GLRIYLESEHGSPLTPRVLHTPPFGVVPRELKMCGSFRMEAQEPLSSEKL

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001152761

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCHFR Protein Vector (Rat) (pPM-C-His)
PV269829 500 ng

GCHFR Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
For 50 mL tube, 2 wells, φ29.0mm, depth 70mm, L71 x W47 x H75mm
MD-MINI-B04 1 Unit

For 50 mL tube, 2 wells, φ29.0mm, depth 70mm, L71 x W47 x H75mm

Sign In for Pricing
View Details
Lentiviral mouse Rcc1l shRNA (UAS) - Lentiviral mouse Rcc1l shRNA (UAS) (25)
GTR15177197 1 Vial

Lentiviral mouse Rcc1l shRNA (UAS) - Lentiviral mouse Rcc1l shRNA (UAS) (25)

Sign In for Pricing
View Details
EGFR monoclonal antibody
orb1495579-01 50 μL

EGFR monoclonal antibody

Sign In for Pricing
View Details
EGFR monoclonal antibody
orb1495579-02 100 µL

EGFR monoclonal antibody

Sign In for Pricing
View Details
EGFR monoclonal antibody
orb1495579-03 200 µL

EGFR monoclonal antibody

Sign In for Pricing
View Details