Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bcl11a Rabbit Polyclonal Antibody (FITC)

Bcl11a Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ev, CTI, Evi, Evi9, Ctip1, Evi9a, Evi9b, Evi9c, BCL-11A, mKIAA1809, 2810047E18Rik, D930021L15Rik

UniProt

Q5STS7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Bcl11a

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GLRIYLESEHGSPLTPRVLHTPPFGVVPRELKMCGSFRMEAQEPLSSEKL

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001152761

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1) ELISA Kit
MBS2025039-01 24 Strip Well

Rat Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1) ELISA Kit

Sign In for Pricing
View Details
Rat Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1) ELISA Kit
MBS2025039-02 48 Strip Well

Rat Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1) ELISA Kit

Sign In for Pricing
View Details
Rat Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1) ELISA Kit
MBS2025039-03 96 Strip Well

Rat Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1) ELISA Kit

Sign In for Pricing
View Details
Rat Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1) ELISA Kit
MBS2025039-04 5x 96 Strip Well

Rat Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1) ELISA Kit

Sign In for Pricing
View Details
Rat Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1) ELISA Kit
MBS2025039-05 10x 96 Strip Well

Rat Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1) ELISA Kit

Sign In for Pricing
View Details
Alkaline phosphatase/ALPL Rabbit Polyclonal Antibody (Biotin)
orb2605391 100 µg

Alkaline phosphatase/ALPL Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details