Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JUN Rabbit Polyclonal Antibody (HRP)

JUN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AP1, p39, AP-1, cJUN, c-Jun

UniProt

P05412

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAAS

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002219

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calreticulin Rabbit Polyclonal Antibody (BF594)
orb1594370 100 µL

Calreticulin Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
HCN1, Human (Hyperpolarization-activated Cyclic Nucleotide-gated channel 1) Control Peptide
H1827-25H 100 µg

HCN1, Human (Hyperpolarization-activated Cyclic Nucleotide-gated channel 1) Control Peptide

Sign In for Pricing
View Details
ZBTB3 discontinued
396258-01 20 µL

ZBTB3 discontinued

Sign In for Pricing
View Details
ZBTB3 discontinued
396258-02 200 µL

ZBTB3 discontinued

Sign In for Pricing
View Details
Sheep anti-Rabbit IgG Heavy and Light Chain Antibody Dylight®650 Conjugated
A120-100D5 0.5 mg

Sheep anti-Rabbit IgG Heavy and Light Chain Antibody Dylight®650 Conjugated

Sign In for Pricing
View Details
PDE11A Protein Vector (Rat) (pPM-C-HA)
PV293008 500 ng

PDE11A Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details