Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pax7 Rabbit Polyclonal Antibody (FITC)

Pax7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RGD1564360

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Pax7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IF, WB

NCBI Accession Number

NP_001178913

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PP2C kappa discontinued
541239-01 30ul

PP2C kappa discontinued

Sign In for Pricing
View Details
PP2C kappa discontinued
541239-02 100 µL

PP2C kappa discontinued

Sign In for Pricing
View Details
Human 26S Proteasome Non-ATPase Regulatory Subunit 3 (PSMD3) ELISA Kit
MBS456915-01 48 Tests

Human 26S Proteasome Non-ATPase Regulatory Subunit 3 (PSMD3) ELISA Kit

Sign In for Pricing
View Details
Human 26S Proteasome Non-ATPase Regulatory Subunit 3 (PSMD3) ELISA Kit
MBS456915-02 96 Tests

Human 26S Proteasome Non-ATPase Regulatory Subunit 3 (PSMD3) ELISA Kit

Sign In for Pricing
View Details
Human 26S Proteasome Non-ATPase Regulatory Subunit 3 (PSMD3) ELISA Kit
MBS456915-03 5x 96 Tests

Human 26S Proteasome Non-ATPase Regulatory Subunit 3 (PSMD3) ELISA Kit

Sign In for Pricing
View Details
Human 26S Proteasome Non-ATPase Regulatory Subunit 3 (PSMD3) ELISA Kit
MBS456915-04 10x 96 Tests

Human 26S Proteasome Non-ATPase Regulatory Subunit 3 (PSMD3) ELISA Kit

Sign In for Pricing
View Details