Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arnt Rabbit Polyclonal Antibody (HRP)

Arnt Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Drnt, Hif1, ESTM4, Hif1b, bHLHe, ESTM42, W08714, bHLHe2, D3Ertd557, mKIAA4051, D3Ertd557e

UniProt

Q3ULM2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DEVEVNTKFLRCDDDQMCNDKERFARENHSEIERRRRNKMTAYITELSDM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033839

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Meta-Topolin Plant Culture Tested
PCT0827-100 mg 100 mg

Meta-Topolin Plant Culture Tested

Sign In for Pricing
View Details
Anti-Human Calcitonin (ABT464) Mouse Monoclonal Antibody (Ready to Use)
MBS9511496-01 3 mL (RTU)

Anti-Human Calcitonin (ABT464) Mouse Monoclonal Antibody (Ready to Use)

Sign In for Pricing
View Details
Anti-Human Calcitonin (ABT464) Mouse Monoclonal Antibody (Ready to Use)
MBS9511496-02 6 mL (RTU)

Anti-Human Calcitonin (ABT464) Mouse Monoclonal Antibody (Ready to Use)

Sign In for Pricing
View Details
Anti-Human Calcitonin (ABT464) Mouse Monoclonal Antibody (Ready to Use)
MBS9511496-03 12 mL (RTU)

Anti-Human Calcitonin (ABT464) Mouse Monoclonal Antibody (Ready to Use)

Sign In for Pricing
View Details
Anti-Human Calcitonin (ABT464) Mouse Monoclonal Antibody (Ready to Use)
MBS9511496-04 5x 12 mL (RTU)

Anti-Human Calcitonin (ABT464) Mouse Monoclonal Antibody (Ready to Use)

Sign In for Pricing
View Details
Epithelial Sodium Channel, alpha, Rat (ENAC Alpha) Control Peptide
E3414-61F 100 µg

Epithelial Sodium Channel, alpha, Rat (ENAC Alpha) Control Peptide

Sign In for Pricing
View Details