Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUX1 Rabbit Polyclonal Antibody (FITC)

CUX1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CDP, CUX, p75, CASP, CDP1, COY1, Clox, GDDI, p100, p110, p200, CUTL1, GOLIM6, CDP/Cut, Cux/CDP, Nbla10317

UniProt

P39880

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence LQSLFGLPEAAGARDSRDNPLRKKKAANLNSIIHRLEKAASREEPIEWEF

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LQSLFGLPEAAGARDSRDNPLRKKKAANLNSIIHRLEKAASREEPIEWEF

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

164 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish

NCBI Accession Number

NP_853530

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD157 HEK293 Overexpression Lysate
MBS8113424-01 0.3 mg

Human CD157 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Human CD157 HEK293 Overexpression Lysate
MBS8113424-02 5x 0.3 mg

Human CD157 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
1-[Ethyl (2-methylphenyl) amino]-3-phenylpropan-2-one
HWB61503-01 50 mg

1-[Ethyl (2-methylphenyl) amino]-3-phenylpropan-2-one

Sign In for Pricing
View Details
1-[Ethyl (2-methylphenyl) amino]-3-phenylpropan-2-one
HWB61503-02 0.5 g

1-[Ethyl (2-methylphenyl) amino]-3-phenylpropan-2-one

Sign In for Pricing
View Details
Gfi1b ORF Vector (Mouse) (pORF)
21452015 1.0 µg DNA

Gfi1b ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CEP128 Polyclonal Antibody
MBS9238786-01 0.1 mL

CEP128 Polyclonal Antibody

Sign In for Pricing
View Details