Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMRT1 Rabbit Polyclonal Antibody (Biotin)

DMRT1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DMT1, CT154

UniProt

Q9Y5R6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DMRT1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSY

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068770.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aspergillus nidulans ANIA_01953 Rabbit Polyclonal Antibody (PE)
orb2570918 200 µL

Aspergillus nidulans ANIA_01953 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Human carbonhydrate antigen 19-9, CA19-9 ELISA Kit
MBS702224-01 24 Well (LIMIT 1)

Human carbonhydrate antigen 19-9, CA19-9 ELISA Kit

Sign In for Pricing
View Details
Human carbonhydrate antigen 19-9, CA19-9 ELISA Kit
MBS702224-02 48 Well

Human carbonhydrate antigen 19-9, CA19-9 ELISA Kit

Sign In for Pricing
View Details
Human carbonhydrate antigen 19-9, CA19-9 ELISA Kit
MBS702224-03 96 Well

Human carbonhydrate antigen 19-9, CA19-9 ELISA Kit

Sign In for Pricing
View Details
Human carbonhydrate antigen 19-9, CA19-9 ELISA Kit
MBS702224-04 5x 96 Well

Human carbonhydrate antigen 19-9, CA19-9 ELISA Kit

Sign In for Pricing
View Details
Human carbonhydrate antigen 19-9, CA19-9 ELISA Kit
MBS702224-05 10x 96 Well

Human carbonhydrate antigen 19-9, CA19-9 ELISA Kit

Sign In for Pricing
View Details