Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP90AA1 Rabbit Polyclonal Antibody (FITC)

HSP90AA1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EL52, HSPN, LAP2, HSP86, HSPC1, HSPCA, Hsp89, Hsp90, LAP-2, HSP89A, HSP90A, HSP90N, Hsp103, HSPCAL1, HSPCAL4, HEL-S-65p

UniProt

P07900

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HSP90AA1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QGAGQHLYKDLQPFILLRLLMPEETQTQDQPMEEEEVETFAFQAEIAQLM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001017963

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Procollagen I N-Terminal Propeptide (PINP) ELISA Kit
orb1664116-01 48 Tests

Human Procollagen I N-Terminal Propeptide (PINP) ELISA Kit

Sign In for Pricing
View Details
Human Procollagen I N-Terminal Propeptide (PINP) ELISA Kit
orb1664116-02 96 Tests

Human Procollagen I N-Terminal Propeptide (PINP) ELISA Kit

Sign In for Pricing
View Details
Rat Crtap Pre-designed siRNA Set A
SI203280A 1 Each

Rat Crtap Pre-designed siRNA Set A

Sign In for Pricing
View Details
LAP
BA9550-1000 1 g

LAP

Sign In for Pricing
View Details
ATP1B2 (13K18) Rabbit Monoclonal Antibody
orb3013489 100 µL

ATP1B2 (13K18) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PRMT5 (Protein Arginine N-methyltransferase 5, 72kD ICln-binding Protein, Histone-arginine N-methyltransferase PRMT5, HRMT1L5, IBP72, Jak-binding Protein 1, JBP1, Shk1 Kinase-binding Protein 1 Homolog, SKB1 Homolog, SKB1Hs, SKB1) (MaxLight 405) discontinued
131838-ML405 100 µL

PRMT5 (Protein Arginine N-methyltransferase 5, 72kD ICln-binding Protein, Histone-arginine N-methyltransferase PRMT5, HRMT1L5, IBP72, Jak-binding Protein 1, JBP1, Shk1 Kinase-binding Protein 1 Homolog, SKB1 Homolog, SKB1Hs, SKB1) (MaxLight 405) discontinued

Sign In for Pricing
View Details