Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP90AA1 Rabbit Polyclonal Antibody (HRP)

HSP90AA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EL52, HSPN, LAP2, HSP86, HSPC1, HSPCA, Hsp89, Hsp90, LAP-2, HSP89A, HSP90A, HSP90N, Hsp103, HSPCAL1, HSPCAL4, HEL-S-65p

UniProt

P07900

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HSP90AA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QGAGQHLYKDLQPFILLRLLMPEETQTQDQPMEEEEVETFAFQAEIAQLM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001017963

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Muscarinic Cholinergic Receptor 2 (M2) -Antibodies IgG (Human)
15200 1 Kit

Anti-Muscarinic Cholinergic Receptor 2 (M2) -Antibodies IgG (Human)

Sign In for Pricing
View Details
Megf11 ORF Vector (Mouse) (pORF)
ORF050052 1.0 µg DNA

Megf11 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
KLHL29 Protein Vector (Mouse) (pPM-C-His)
PV194701 500 ng

KLHL29 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Rat MIP-1beta ELISA Kit
orb567529-01 48 Tests

Rat MIP-1beta ELISA Kit

Sign In for Pricing
View Details
Rat MIP-1beta ELISA Kit
orb567529-02 96 Tests

Rat MIP-1beta ELISA Kit

Sign In for Pricing
View Details
GoldBand™ Plus 3-color Regular Range Protein Marker (8-180 kDa)
20350ES76 2x 250 μL

GoldBand™ Plus 3-color Regular Range Protein Marker (8-180 kDa)

Sign In for Pricing
View Details