Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBL1 Rabbit Polyclonal Antibody (HRP)

RBL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PRB1, p107, CP107

UniProt

P28749

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence NMIRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NMIRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

121 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_002886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal J Chain Antibody (Mc19-9) [DyLight 550]
NB100-64825R 0.1 mL

Mouse Monoclonal J Chain Antibody (Mc19-9) [DyLight 550]

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans C29G2.6 Polyclonal Antibody
MBS7180254 Inquire

Rabbit anti-Caenorhabditis elegans C29G2.6 Polyclonal Antibody

Sign In for Pricing
View Details
4-Chloro-5-fluoro-1- (phenylsulfonyl) -1h-pyrrolo-[2,3-b]pyridine
431715-01 25 mg

4-Chloro-5-fluoro-1- (phenylsulfonyl) -1h-pyrrolo-[2,3-b]pyridine

Sign In for Pricing
View Details
4-Chloro-5-fluoro-1- (phenylsulfonyl) -1h-pyrrolo-[2,3-b]pyridine
431715-02 50 mg

4-Chloro-5-fluoro-1- (phenylsulfonyl) -1h-pyrrolo-[2,3-b]pyridine

Sign In for Pricing
View Details
MAP7D1 Polyclonal Antibody, PerCP Conjugated
bs-9314R-PerCP-01 20 µL

MAP7D1 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
MAP7D1 Polyclonal Antibody, PerCP Conjugated
bs-9314R-PerCP-02 100 µL

MAP7D1 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details