Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBL1 Rabbit Polyclonal Antibody (Biotin)

RBL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PRB1, p107, CP107

UniProt

P28749

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence NMIRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NMIRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

121 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_002886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFAP1L1 Human Gene Knockout Kit (CRISPR)
KN418676 1 Kit

AFAP1L1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Car5a Mouse Gene Knockout Kit (CRISPR)
KN502535 1 Kit

Car5a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nesprin 1 (SYNE1) Human Gene Knockout Kit (CRISPR)
KN212694RB 1 Kit

Nesprin 1 (SYNE1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AF9 (MLLT3) (N-term) Rabbit Polyclonal Antibody
AP13159PU-N 400 µL

AF9 (MLLT3) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CRISPLD1 (NM_031461) Human Over-expression Lysate
LY403118 100 µg

CRISPLD1 (NM_031461) Human Over-expression Lysate

Sign In for Pricing
View Details
LDL Receptor (LDLR) (NM_000527) Human Recombinant Protein
TP720505 10 µg

LDL Receptor (LDLR) (NM_000527) Human Recombinant Protein

Sign In for Pricing
View Details