Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBL2 Rabbit Polyclonal Antibody (Biotin)

RBL2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Rb2, P130

UniProt

B7Z913

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human RBL2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NETMLSPREKIFYYFSNSPSKRLREINSMIRTGETPTKKRGILLEDGSES

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005602.3

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERK 3 Polyclonal Antibody
E-AB-12398-01 20 µL

ERK 3 Polyclonal Antibody

Sign In for Pricing
View Details
ERK 3 Polyclonal Antibody
E-AB-12398-02 60 µL

ERK 3 Polyclonal Antibody

Sign In for Pricing
View Details
ERK 3 Polyclonal Antibody
E-AB-12398-03 120 µL

ERK 3 Polyclonal Antibody

Sign In for Pricing
View Details
ERK 3 Polyclonal Antibody
E-AB-12398-04 200 µL

ERK 3 Polyclonal Antibody

Sign In for Pricing
View Details
Pseudomonas aeruginosa serotype 6C (1200/472), CF740 conjugate, 0.1mg/mL
BNC740240-500 1x 500 µL

Pseudomonas aeruginosa serotype 6C (1200/472), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 Recombinant Monoclonal Mouse Antibody (2310.9), CF®405M Conjugate - Biotium Choice
P015-405M-500 1x 500 µL

CD9 Recombinant Monoclonal Mouse Antibody (2310.9), CF®405M Conjugate - Biotium Choice

Sign In for Pricing
View Details