Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFAP2A Rabbit Polyclonal Antibody (HRP)

TFAP2A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AP-2, BOFS, AP2TF, TFAP2, AP-2alpha

UniProt

P05549

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human AP2A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLA

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003211

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lysosome Associated Membrane Protein 2 (LAMP 2, Igp2, Igp110, CD107b, LAMP2C, LAMPB, Lysosome Associated Membrane Glycoprotein 2 Precursor, MAC3) discontinued, see L9190-15
L9190-12D1 100 µg

Lysosome Associated Membrane Protein 2 (LAMP 2, Igp2, Igp110, CD107b, LAMP2C, LAMPB, Lysosome Associated Membrane Glycoprotein 2 Precursor, MAC3) discontinued, see L9190-15

Sign In for Pricing
View Details
KRTCAP3 Recombinant Protein (Rat)
RP207707 100 µg

KRTCAP3 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Calretinin control protein
214-1P 100 µg

Calretinin control protein

Sign In for Pricing
View Details
WDR36 polyclonal antibody
BS72720-01 50 µL

WDR36 polyclonal antibody

Sign In for Pricing
View Details
WDR36 polyclonal antibody
BS72720-02 100 µL

WDR36 polyclonal antibody

Sign In for Pricing
View Details
SHENTEK® Residual E. coli DNA Quantitation Kit (2G)
1101107-1 100 Reactions

SHENTEK® Residual E. coli DNA Quantitation Kit (2G)

Sign In for Pricing
View Details