Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFAP2A Rabbit Polyclonal Antibody (HRP)

TFAP2A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AP-2, BOFS, AP2TF, TFAP2, AP-2alpha

UniProt

P05549

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human AP2A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLA

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003211

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain RM11-1a)(Baker's yeast) AIM9 Polyclonal Antibody
MBS7171232 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain RM11-1a)(Baker's yeast) AIM9 Polyclonal Antibody

Sign In for Pricing
View Details
Cnbp Mouse shRNA Plasmid (Locus ID 12785)
TR500389 1 Kit

Cnbp Mouse shRNA Plasmid (Locus ID 12785)

Sign In for Pricing
View Details
Sodium Metaperiodate 99.8% AR
02448 00100 100 g

Sodium Metaperiodate 99.8% AR

Sign In for Pricing
View Details
EXOSC7 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-61884R-BF680 100 µL

EXOSC7 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Anti-Phospho-Rb (S807) Rabbit Monoclonal Antibody
MBS1750198-01 0.03 mL

Anti-Phospho-Rb (S807) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-Rb (S807) Rabbit Monoclonal Antibody
MBS1750198-02 0.1 mL

Anti-Phospho-Rb (S807) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details