Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atf7 Rabbit Polyclonal Antibody (HRP)

Atf7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HKDCPVTALQKKTQGYLESPKESSEPTGSPAPVIQHSSATAPSNGLSVRS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001101585

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Livin Rabbit Polyclonal Antibody (Cy7)
orb1053765 100 µL

Livin Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
GLUDP4 CRISPRa sgRNA lentivector (set of three targets)(Human)
58087121 3x 1.0µg DNA

GLUDP4 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
CFI Rabbit pAb
E45R25954N-100 100 µL

CFI Rabbit pAb

Sign In for Pricing
View Details
2,5-Dichloro-pyridine-3-sulfonyl chloride
IYB08136-01 0.5 g

2,5-Dichloro-pyridine-3-sulfonyl chloride

Sign In for Pricing
View Details
2,5-Dichloro-pyridine-3-sulfonyl chloride
IYB08136-02 5 g

2,5-Dichloro-pyridine-3-sulfonyl chloride

Sign In for Pricing
View Details
Rabbit anti-Solanum tuberosum (Potato) PSBE Polyclonal Antibody
MBS7192906 Inquire

Rabbit anti-Solanum tuberosum (Potato) PSBE Polyclonal Antibody

Sign In for Pricing
View Details