Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB3 Rabbit Polyclonal Antibody (HRP)

HOXB3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HOX2, HOX2G, Hox-2.7

UniProt

P14651

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GPSKSGPPKCGPGTNSTLTKQIFPWMKESRQTSKLKNNSPGTAEGCGGGG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002137

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ACCN4 (ASIC4) activation kit by CRISPRa
GA110772 1 Kit

Human ACCN4 (ASIC4) activation kit by CRISPRa

Sign In for Pricing
View Details
4-Penten-1-amine Hydrochloride
TRC-P227403-2.5G 2.5 g

4-Penten-1-amine Hydrochloride

Sign In for Pricing
View Details
Mouse Gad1 activation kit by CRISPRa
GA201529 1 Kit

Mouse Gad1 activation kit by CRISPRa

Sign In for Pricing
View Details
P57 / KIP2 (KIP2/880), CF568 conjugate, 0.1mg/mL
BNC680880-500 1x 500 µL

P57 / KIP2 (KIP2/880), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-(N-tert-Butoxycarbonyl)aminobenzoic Acid-d4
TRC-B690842-1MG 1 mg

4-(N-tert-Butoxycarbonyl)aminobenzoic Acid-d4

Sign In for Pricing
View Details
CHIT1 Human Gene Knockout Kit (CRISPR)
KN419169 1 Kit

CHIT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details