Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nfe2l1 Rabbit Polyclonal Antibody (Biotin)

Nfe2l1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NR, Lcr, LCR-, NRF1, Lcrf1, TCF11, LCR-F1, TCF-11, AA408798, AW212678

UniProt

Q3V3M1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Nfe2l1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EVFGRLRDEHGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKD

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032712

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SM22 Alpha/Transgelin Antibody
orb18630 100 µg

SM22 Alpha/Transgelin Antibody

Sign In for Pricing
View Details
4-Hydroxy Atorvastatin-d5 Disodium
CS-O-02780 1 Each

4-Hydroxy Atorvastatin-d5 Disodium

Sign In for Pricing
View Details
Lentiviral human PLK2 shRNA (UAS) - Lentiviral human PLK2 shRNA (UAS) (100)
GTR15110934 1 Vial

Lentiviral human PLK2 shRNA (UAS) - Lentiviral human PLK2 shRNA (UAS) (100)

Sign In for Pricing
View Details
CD105 (human), mAb (SN6/N1-3A1)
ANC-326-060 120 Tests

CD105 (human), mAb (SN6/N1-3A1)

Sign In for Pricing
View Details
Creatine Kinase BB Isoenzyme (CKBB, Brain Creatine Kinase, B-CK, Creatine Kinase B, Creatine Kinase B Chain, Creatine Kinase B-type, Creatine Kinase Brain, CKB, Creatine Phosphokinase BB) (AP) discontinued
C7910-14E-AP 100 µL

Creatine Kinase BB Isoenzyme (CKBB, Brain Creatine Kinase, B-CK, Creatine Kinase B, Creatine Kinase B Chain, Creatine Kinase B-type, Creatine Kinase Brain, CKB, Creatine Phosphokinase BB) (AP) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Wdr70 shRNA (UAS) - Lentiviral mouse Wdr70 shRNA (UAS, GFP) (100)
GTR15241533 1 Vial

Lentiviral mouse Wdr70 shRNA (UAS) - Lentiviral mouse Wdr70 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details