Nfe2l1 Rabbit Polyclonal Antibody (Biotin)
Nfe2l1 Rabbit Polyclonal Antibody (Biotin)
Product Specifications
Product Name Alternative
NR, Lcr, LCR-, NRF1, Lcrf1, TCF11, LCR-F1, TCF-11, AA408798, AW212678
UniProt
Q3V3M1
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Nfe2l1
Clonality
Polyclonal
Conjugation
Biotin
Sequence
Synthetic peptide located within the following region: EVFGRLRDEHGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKD
Field of Research
Metabolism Research
Purification
Affinity Purified
Form
Liquid. Purified antibody supplied in 1x PBS buffer.
Molecular Weight
49kDa
Storage Conditions
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Notes
For research use only.
Prediction Reactivity
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Tested Applications
WB
NCBI Accession Number
NP_032712
Host or Source
Rabbit
Preservative
Liquid. Purified antibody supplied in 1x PBS buffer.
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A08230-2-Dylight594 100 µg
Anti-DLGAP1 Antibody Picoband®, Dylight594 Conjugate
Sign In for Pricing
View Details 
MBS6341406-01 0.1 mL
RETNLB, ID (RETNLB, CCRG, FIZZ2, HXCP2, RETNL2, Resistin-like beta, Colon and small intestine-specific cysteine-rich protein, Colon carcinoma-related gene protein, Cysteine-rich secreted protein A12-alpha-like 1, Cysteine-rich secreted protein FIZZ2, RELM
Sign In for Pricing
View Details MBS6341406-02 5x 0.1 mL
RETNLB, ID (RETNLB, CCRG, FIZZ2, HXCP2, RETNL2, Resistin-like beta, Colon and small intestine-specific cysteine-rich protein, Colon carcinoma-related gene protein, Cysteine-rich secreted protein A12-alpha-like 1, Cysteine-rich secreted protein FIZZ2, RELM
Sign In for Pricing
View Details MBS8123758-01 0.1 mg
SARS-CoV-2 Spike S1 (T19R, E156G, 157-158 deletion, L452R, T478K, D614G, P681R) Protein (His Tag)
Sign In for Pricing
View Details MBS8123758-02 5x 0.1 mg
SARS-CoV-2 Spike S1 (T19R, E156G, 157-158 deletion, L452R, T478K, D614G, P681R) Protein (His Tag)
Sign In for Pricing
View Details 
043395-Biotin 200 µL
TSSC1, CT (TSSC1, Protein TSSC1, Tumor-suppressing STF cDNA 1 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 1 protein) (Biotin) discontinued
Sign In for Pricing
View Details