Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFE2 Rabbit Polyclonal Antibody (FITC)

NFE2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P45, NF-E2

UniProt

Q16621

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NFE2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_006154

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASTM Method D5580 Valve Timing Calibration Mixture (set of 5x1 ml), 6 components
F112131.5 5 mL

ASTM Method D5580 Valve Timing Calibration Mixture (set of 5x1 ml), 6 components

Sign In for Pricing
View Details
BCL11B Protein Vector (Human) (pPB-C-His)
PV064461 500 ng

BCL11B Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
mmu-mir-214-3p RT-PCR Detection and U6 Calibration Kit
abx096690-01 50 Reactions

mmu-mir-214-3p RT-PCR Detection and U6 Calibration Kit

Sign In for Pricing
View Details
mmu-mir-214-3p RT-PCR Detection and U6 Calibration Kit
abx096690-02 100 Reactions

mmu-mir-214-3p RT-PCR Detection and U6 Calibration Kit

Sign In for Pricing
View Details
mmu-mir-214-3p RT-PCR Detection and U6 Calibration Kit
abx096690-03 200 Reactions

mmu-mir-214-3p RT-PCR Detection and U6 Calibration Kit

Sign In for Pricing
View Details
IGHV1-24 3'UTR GFP Stable Cell Line
TU060614 1.0 mL

IGHV1-24 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details