Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snapc1 Rabbit Polyclonal Antibody (FITC)

Snapc1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

B1WC17

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MEAPAGSSTRPMGAGTLEGVGIPPGLQTDCETLLSRFQEMDSVRFEDFAE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001101503

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)
MBS1153194-01 0.02 mg (E-Coli)

Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)
MBS1153194-02 0.1 mg (E-Coli)

Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)
MBS1153194-03 0.02 mg (Yeast)

Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)
MBS1153194-04 0.1 mg (Yeast)

Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)
MBS1153194-05 0.02 mg (Baculovirus)

Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)
MBS1153194-06 1 mg (E-Coli)

Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)

Sign In for Pricing
View Details