Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RARB Rabbit Polyclonal Antibody (FITC)

RARB Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HAP, RRB2, NR1B2, MCOPS12, RARbeta1

UniProt

P10826

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RARB

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EKALKACFSGLTQTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melanoma Marker (HMB45 + A103 + T311), CF647 conjugate, 0.1mg/mL
BNC470702-100 1x 100 µL

Melanoma Marker (HMB45 + A103 + T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CC16 (Clara Cell16kD protein) ELISA Kit
E-EL-H6205-01 24 Tests

Human CC16 (Clara Cell16kD protein) ELISA Kit

Sign In for Pricing
View Details
Human CC16 (Clara Cell16kD protein) ELISA Kit
E-EL-H6205-02 48 Tests

Human CC16 (Clara Cell16kD protein) ELISA Kit

Sign In for Pricing
View Details
Human CC16 (Clara Cell16kD protein) ELISA Kit
E-EL-H6205-03 96 Tests

Human CC16 (Clara Cell16kD protein) ELISA Kit

Sign In for Pricing
View Details
DIRAS1 Polyclonal Antibody
E-AB-13199-01 20 µL

DIRAS1 Polyclonal Antibody

Sign In for Pricing
View Details
DIRAS1 Polyclonal Antibody
E-AB-13199-02 60 µL

DIRAS1 Polyclonal Antibody

Sign In for Pricing
View Details