Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RARB Rabbit Polyclonal Antibody (HRP)

RARB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HAP, RRB2, NR1B2, MCOPS12, RARbeta1

UniProt

P10826

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RARB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKALKACFSGLTQTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FZD3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0825508 1.0 µg DNA

FZD3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human MVD siRNA
abx903399-01 15 nmol

Human MVD siRNA

Sign In for Pricing
View Details
Human MVD siRNA
abx903399-02 30 nmol

Human MVD siRNA

Sign In for Pricing
View Details
Glucose Content Assay Kit
AK0219-100T-96S 100 Tests - 96 Samples

Glucose Content Assay Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Myotubularin Related Protein 10 Antibody
NBP2-30553-25ul 25 µL

Rabbit Polyclonal Myotubularin Related Protein 10 Antibody

Sign In for Pricing
View Details
Inhibitor hsa-miR-5699-5p AAV miRNA Vector
Amh3200100 500 ng

Inhibitor hsa-miR-5699-5p AAV miRNA Vector

Sign In for Pricing
View Details