Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEAD1 Rabbit Polyclonal Antibody (Biotin)

TEAD1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AA, REF1, TCF13, TEF-1, NTEF-1, TCF-13, TEAD-1

UniProt

P28347

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TEAD1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PASAPAPSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_068780

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD140b/PDGFRB Antibody (28D4), APC
FHC42223 100 Tests

Anti-Human CD140b/PDGFRB Antibody (28D4), APC

Sign In for Pricing
View Details
PRK2 (Serine/Threonine-protein Kinase N2, PKN gamma, Protein Kinase C-like 2, Protein-kinase C-related Kinase 2, PKN2, PRKCL2, MGC150606, MGC71074) (HRP)
131771-HRP 100 µL

PRK2 (Serine/Threonine-protein Kinase N2, PKN gamma, Protein Kinase C-like 2, Protein-kinase C-related Kinase 2, PKN2, PRKCL2, MGC150606, MGC71074) (HRP)

Sign In for Pricing
View Details
Recombinant Synechocystis sp. Photosystem II manganese-stabilizing polypeptide (psbO)
MBS1185261-01 0.02 mg (E-Coli)

Recombinant Synechocystis sp. Photosystem II manganese-stabilizing polypeptide (psbO)

Sign In for Pricing
View Details
Recombinant Synechocystis sp. Photosystem II manganese-stabilizing polypeptide (psbO)
MBS1185261-02 0.1 mg (E-Coli)

Recombinant Synechocystis sp. Photosystem II manganese-stabilizing polypeptide (psbO)

Sign In for Pricing
View Details
Recombinant Synechocystis sp. Photosystem II manganese-stabilizing polypeptide (psbO)
MBS1185261-03 0.02 mg (Yeast)

Recombinant Synechocystis sp. Photosystem II manganese-stabilizing polypeptide (psbO)

Sign In for Pricing
View Details
Recombinant Synechocystis sp. Photosystem II manganese-stabilizing polypeptide (psbO)
MBS1185261-04 0.1 mg (Yeast)

Recombinant Synechocystis sp. Photosystem II manganese-stabilizing polypeptide (psbO)

Sign In for Pricing
View Details