Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEBPB Rabbit Polyclonal Antibody (Biotin)

CEBPB Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TCF5, IL6DBP, NF-IL6, C/EBP-beta

UniProt

P17676

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CEBPB

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_005185

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSC2, Phosphorylated (S1365) (Tsc2, Tuberin, Tuberous sclerosis 2 protein homolog) (MaxLight 650)
MBS6359339-01 0.1 mL

TSC2, Phosphorylated (S1365) (Tsc2, Tuberin, Tuberous sclerosis 2 protein homolog) (MaxLight 650)

Sign In for Pricing
View Details
TSC2, Phosphorylated (S1365) (Tsc2, Tuberin, Tuberous sclerosis 2 protein homolog) (MaxLight 650)
MBS6359339-02 5x 0.1 mL

TSC2, Phosphorylated (S1365) (Tsc2, Tuberin, Tuberous sclerosis 2 protein homolog) (MaxLight 650)

Sign In for Pricing
View Details
Lentiviral human LMNTD1 sgRNA gene knockout kit - Lentiviral human LMNTD1 sgRNA gene knockout kit (25)
GTR15384642 1 Vial

Lentiviral human LMNTD1 sgRNA gene knockout kit - Lentiviral human LMNTD1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Human GH2 ELISA Kit
orb564203-01 48 Tests

Human GH2 ELISA Kit

Sign In for Pricing
View Details
Human GH2 ELISA Kit
orb564203-02 96 Tests

Human GH2 ELISA Kit

Sign In for Pricing
View Details
C1orf43 Protein Vector (Human) (pPM-N-D-C-HA)
PV330080 500 ng

C1orf43 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details