Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dr1 Rabbit Polyclonal Antibody (HRP)

Dr1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dr, NC, NC2, Dr1l, NC2be, NC2beta, 1700121L09Rik

UniProt

Q91WV0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080382

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MT1A Protein Lysate
MBS8415568-01 0.02 mg

Human MT1A Protein Lysate

Sign In for Pricing
View Details
Human MT1A Protein Lysate
MBS8415568-02 5x 0.02 mg

Human MT1A Protein Lysate

Sign In for Pricing
View Details
TFDP2 Antibody
CSB-PA447196-01 50 μL

TFDP2 Antibody

Sign In for Pricing
View Details
TFDP2 Antibody
CSB-PA447196-02 100 µL

TFDP2 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Ncbp2 shRNA (UAS) - Lentiviral mouseNcbp2 shRNA (UAS, GFP) (25)
GTR15207956 1 Vial

Lentiviral mouse Ncbp2 shRNA (UAS) - Lentiviral mouseNcbp2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Phospho-Akt (S473) Mouse Monoclonal Antibody (6F8)
orb397210-01 50 μL

Phospho-Akt (S473) Mouse Monoclonal Antibody (6F8)

Sign In for Pricing
View Details