Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxc6 Rabbit Polyclonal Antibody (HRP)

Hoxc6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

G3V841

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Hoxc6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

XP_003750463

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CINP Mouse Monoclonal Antibody [Clone ID: OTI8E4]
CF812290 100 µg

CINP Mouse Monoclonal Antibody [Clone ID: OTI8E4]

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR560661 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Frozen Tissue Sections, Fallopian tube
CS500024 5x 5 µm

Frozen Tissue Sections, Fallopian tube

Sign In for Pricing
View Details
MTRF1L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B5]
TA501067BM 100 µL

MTRF1L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B5]

Sign In for Pricing
View Details
Estriol Recombinant Rabbit monoclonal Antibody
HA751581 100 µL

Estriol Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (r1415-1), CF594 conjugate, 0.1mg/mL
BNC941797-500 1x 500 µL

Histone H1 (Nuclear Marker) (r1415-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details