Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxc6 Rabbit Polyclonal Antibody (Biotin)

Hoxc6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

G3V841

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Hoxc6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

XP_003750463

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC2 Human Pre-designed siRNA Set A
HY-RS03881 1 Set

DNAJC2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Xanthomonas oryzae pv. oryzae Phosphoserine aminotransferase (serC)
MBS1486237-01 0.02 mg (E-Coli)

Recombinant Xanthomonas oryzae pv. oryzae Phosphoserine aminotransferase (serC)

Sign In for Pricing
View Details
Recombinant Xanthomonas oryzae pv. oryzae Phosphoserine aminotransferase (serC)
MBS1486237-02 0.02 mg (Yeast)

Recombinant Xanthomonas oryzae pv. oryzae Phosphoserine aminotransferase (serC)

Sign In for Pricing
View Details
Recombinant Xanthomonas oryzae pv. oryzae Phosphoserine aminotransferase (serC)
MBS1486237-03 0.1 mg (E-Coli)

Recombinant Xanthomonas oryzae pv. oryzae Phosphoserine aminotransferase (serC)

Sign In for Pricing
View Details
Recombinant Xanthomonas oryzae pv. oryzae Phosphoserine aminotransferase (serC)
MBS1486237-04 0.1 mg (Yeast)

Recombinant Xanthomonas oryzae pv. oryzae Phosphoserine aminotransferase (serC)

Sign In for Pricing
View Details
Recombinant Xanthomonas oryzae pv. oryzae Phosphoserine aminotransferase (serC)
MBS1486237-05 0.02 mg (Baculovirus)

Recombinant Xanthomonas oryzae pv. oryzae Phosphoserine aminotransferase (serC)

Sign In for Pricing
View Details