Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISL1 Rabbit Polyclonal Antibody (HRP)

ISL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Isl-1, ISLET1

UniProt

P61371

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ISL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xylitol for biochemistry
2256GR030 30 g

Xylitol for biochemistry

Sign In for Pricing
View Details
Collectin Liver 1 (CLL1) Guinea Pig ELISA Kit
C4134 96 Tests

Collectin Liver 1 (CLL1) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
N-(3-Amino[1,1'-biphenyl]-4-yl)-carbamic Acid tert-Butyl Ester
TRC-A601620-50MG 50 mg

N-(3-Amino[1,1'-biphenyl]-4-yl)-carbamic Acid tert-Butyl Ester

Sign In for Pricing
View Details
FAM24B (NM_152644) Human Recombinant Protein
TP307710L 1 mg

FAM24B (NM_152644) Human Recombinant Protein

Sign In for Pricing
View Details
Arhgef9, ID (Rho Guanine Nucleotide Exchange Factor 9, Rac/Cdc42 Guanine Nucleotide Exchange Factor 9, Collybistin, PEM-2 Homolog, KIAA0424) (MaxLight 405) discontinued
A3570-66P1-ML405 100 µL

Arhgef9, ID (Rho Guanine Nucleotide Exchange Factor 9, Rac/Cdc42 Guanine Nucleotide Exchange Factor 9, Collybistin, PEM-2 Homolog, KIAA0424) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Keratin 18 Rabbit Monoclonal Antibody [KD Validation]
E51K2847 40 µL

Keratin 18 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details