Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISL1 Rabbit Polyclonal Antibody (HRP)

ISL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Isl-1, ISLET1

UniProt

P61371

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ISL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Axl Antibody (108724R) [mFluor Violet 450 SE]
FAB154RMFV450 0.1 mL

Mouse Monoclonal Axl Antibody (108724R) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Mirco Carotenoid Content Assay Kit
MBS9719635-01 48 Tests

Mirco Carotenoid Content Assay Kit

Sign In for Pricing
View Details
Mirco Carotenoid Content Assay Kit
MBS9719635-02 96 Tests

Mirco Carotenoid Content Assay Kit

Sign In for Pricing
View Details
Mirco Carotenoid Content Assay Kit
MBS9719635-03 5x 96 Tests

Mirco Carotenoid Content Assay Kit

Sign In for Pricing
View Details
Rabbit Anti-DDX19B antibody
SL3764R-01 50 µL

Rabbit Anti-DDX19B antibody

Sign In for Pricing
View Details
Rabbit Anti-DDX19B antibody
SL3764R-02 100 µL

Rabbit Anti-DDX19B antibody

Sign In for Pricing
View Details