Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISL1 Rabbit Polyclonal Antibody (Biotin)

ISL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Isl-1, ISLET1

UniProt

P61371

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ISL1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oocyte-expressed protein homolog (OOEP) Mouse ELISA Kit
F5800 96 Tests

Oocyte-expressed protein homolog (OOEP) Mouse ELISA Kit

Sign In for Pricing
View Details
Human Lymphocyte antigen 6 complex locus protein G5c, LY6G5C ELISA Kit
MBS9335916-01 48 Well

Human Lymphocyte antigen 6 complex locus protein G5c, LY6G5C ELISA Kit

Sign In for Pricing
View Details
Human Lymphocyte antigen 6 complex locus protein G5c, LY6G5C ELISA Kit
MBS9335916-02 96 Well

Human Lymphocyte antigen 6 complex locus protein G5c, LY6G5C ELISA Kit

Sign In for Pricing
View Details
Human Lymphocyte antigen 6 complex locus protein G5c, LY6G5C ELISA Kit
MBS9335916-03 5x 96 Well

Human Lymphocyte antigen 6 complex locus protein G5c, LY6G5C ELISA Kit

Sign In for Pricing
View Details
Human Lymphocyte antigen 6 complex locus protein G5c, LY6G5C ELISA Kit
MBS9335916-04 10x 96 Well

Human Lymphocyte antigen 6 complex locus protein G5c, LY6G5C ELISA Kit

Sign In for Pricing
View Details
SEPT3 Protein Vector (Mouse) (pPB-N-His)
PV227827 500 ng

SEPT3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details