Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Taf12 Rabbit Polyclonal Antibody (FITC)

Taf12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

20kD, Taf2, 20kDa, Taf2J, AW557038, 2810422D08Rik

UniProt

Q16514

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079855

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vhl Mouse Gene Knockout Kit (CRISPR)
KN318888LP 1 Kit

Vhl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Porcine CD4a Mouse Monoclonal Antibody [Clone ID: 74-12-4]
AM08106RP-N 100 µg

Porcine CD4a Mouse Monoclonal Antibody [Clone ID: 74-12-4]

Sign In for Pricing
View Details
Human hs-CRP (high-sensitivity C-reactive protein) CLIA Kit
E-CL-H1451-01 24 Tests

Human hs-CRP (high-sensitivity C-reactive protein) CLIA Kit

Sign In for Pricing
View Details
Human hs-CRP (high-sensitivity C-reactive protein) CLIA Kit
E-CL-H1451-02 48 Tests

Human hs-CRP (high-sensitivity C-reactive protein) CLIA Kit

Sign In for Pricing
View Details
Human hs-CRP (high-sensitivity C-reactive protein) CLIA Kit
E-CL-H1451-03 96 Tests

Human hs-CRP (high-sensitivity C-reactive protein) CLIA Kit

Sign In for Pricing
View Details
Serum Amyloid A (SAA/326), CF647 conjugate, 0.1mg/mL
BNC470326-500 1x 500 µL

Serum Amyloid A (SAA/326), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details