Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNH Rabbit Polyclonal Antibody (HRP)

CCNH Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAK, p34, p37, CycH

UniProt

P51946

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CCNH

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001230

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Transmembrane Protein 62 (TMEM62) ELISA Kit
MBS9713939-01 48 Tests

Human Transmembrane Protein 62 (TMEM62) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane Protein 62 (TMEM62) ELISA Kit
MBS9713939-02 96 Tests

Human Transmembrane Protein 62 (TMEM62) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane Protein 62 (TMEM62) ELISA Kit
MBS9713939-03 5x 96 Tests

Human Transmembrane Protein 62 (TMEM62) ELISA Kit

Sign In for Pricing
View Details
RHOH (Ras Homolog Gene Family, Member H, ARHH, TTF) (MaxLight 405) discontinued
251109-ML405 100 µL

RHOH (Ras Homolog Gene Family, Member H, ARHH, TTF) (MaxLight 405) discontinued

Sign In for Pricing
View Details
3-​O-​Acetyloleanolic acid
M20345-01 1 g

3-​O-​Acetyloleanolic acid

Sign In for Pricing
View Details
3-​O-​Acetyloleanolic acid
M20345-02 5 mg

3-​O-​Acetyloleanolic acid

Sign In for Pricing
View Details