Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK7 Rabbit Polyclonal Antibody (HRP)

CDK7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAK, CAK1, HCAK, MO15, STK1, CDKN7, p39MO15

UniProt

P50613

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDK7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDG

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001790

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1000µL Sterile Bulk Tips for Rainin LTS Pipettes
ALF-1000-S-B 1000 Tips x 10 Packs

1000µL Sterile Bulk Tips for Rainin LTS Pipettes

Sign In for Pricing
View Details
Mouse AKR1B1 ELISA Kit
E043204 1 Each

Mouse AKR1B1 ELISA Kit

Sign In for Pricing
View Details
Genistein 7,4'-di-O-β-D-glucoside
HY-N5103-01 1 mg

Genistein 7,4'-di-O-β-D-glucoside

Sign In for Pricing
View Details
Genistein 7,4'-di-O-β-D-glucoside
HY-N5103-02 5 mg

Genistein 7,4'-di-O-β-D-glucoside

Sign In for Pricing
View Details
Monkey Thioredoxin-Related Transmembrane Protein 2 (TMX2) ELISA Kit
MBS9938835-01 48 Well

Monkey Thioredoxin-Related Transmembrane Protein 2 (TMX2) ELISA Kit

Sign In for Pricing
View Details
Monkey Thioredoxin-Related Transmembrane Protein 2 (TMX2) ELISA Kit
MBS9938835-02 96 Well

Monkey Thioredoxin-Related Transmembrane Protein 2 (TMX2) ELISA Kit

Sign In for Pricing
View Details