Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyhr1 Rabbit Polyclonal Antibody (HRP)

Cyhr1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ch, Chrp, AU042374, 1110031M01Rik

UniProt

Q9QXA1

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LAPGPSTHEDCLAGAWVATVIGLPLLAFDFHWVNGDRSSANLLLGGGMVL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_851293

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF4 Antibody
E10-30495 100 µL

FGF4 Antibody

Sign In for Pricing
View Details
Monkey Thromboxane B1 ELISA kit
GTR10384275 96 Well

Monkey Thromboxane B1 ELISA kit

Sign In for Pricing
View Details
HIF1 beta (ARNT) Mouse Monoclonal Antibody [Clone ID: OTI1D10]
CF501148 100 µg

HIF1 beta (ARNT) Mouse Monoclonal Antibody [Clone ID: OTI1D10]

Sign In for Pricing
View Details
RFXANK (DNA-binding Protein RFXANK, Ankyrin Repeat Family A Protein 1, Regulatory Factor X Subunit B, RFX-B, Regulatory Factor X-associated Ankyrin-containing Protein, ANKRA1, RFXB, F14150_1, MGC138628) APC
MBS6138702-01 0.1 mL

RFXANK (DNA-binding Protein RFXANK, Ankyrin Repeat Family A Protein 1, Regulatory Factor X Subunit B, RFX-B, Regulatory Factor X-associated Ankyrin-containing Protein, ANKRA1, RFXB, F14150_1, MGC138628) APC

Sign In for Pricing
View Details
RFXANK (DNA-binding Protein RFXANK, Ankyrin Repeat Family A Protein 1, Regulatory Factor X Subunit B, RFX-B, Regulatory Factor X-associated Ankyrin-containing Protein, ANKRA1, RFXB, F14150_1, MGC138628) APC
MBS6138702-02 5x 0.1 mL

RFXANK (DNA-binding Protein RFXANK, Ankyrin Repeat Family A Protein 1, Regulatory Factor X Subunit B, RFX-B, Regulatory Factor X-associated Ankyrin-containing Protein, ANKRA1, RFXB, F14150_1, MGC138628) APC

Sign In for Pricing
View Details
ZNF230 Mouse Monoclonal Antibody [Clone ID: LBI8F8]
AMM18777VCF 100 µg

ZNF230 Mouse Monoclonal Antibody [Clone ID: LBI8F8]

Sign In for Pricing
View Details