Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxb1 Rabbit Polyclonal Antibody (HRP)

Hoxb1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hox-2., Hox-2.9

UniProt

P17919

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ETQVKIWFQNRRMKQKKREREGGRMPAGPPGCPKEAAGDASDQSACTSPE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032292

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPAMD8 Protein Lysate (Human) with C-Ha Tag
16738031 100 µg

CPAMD8 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
AAV6 standard material (eGFP)
66V061 100 µL

AAV6 standard material (eGFP)

Sign In for Pricing
View Details
Rabbit Polyclonal Sulfamidase/SGSH Antibody
NBP1-83165-25ul 25 µL

Rabbit Polyclonal Sulfamidase/SGSH Antibody

Sign In for Pricing
View Details
NAPB, NT (NAPB, SNAPB, Beta-soluble NSF attachment protein, N-ethylmaleimide-sensitive factor attachment protein beta) (APC) discontinued
038792-APC 200 µL

NAPB, NT (NAPB, SNAPB, Beta-soluble NSF attachment protein, N-ethylmaleimide-sensitive factor attachment protein beta) (APC) discontinued

Sign In for Pricing
View Details
OR2T29 (NM_001004694) Human Tagged ORF Clone
RC217894 10 µg

OR2T29 (NM_001004694) Human Tagged ORF Clone

Sign In for Pricing
View Details
CHKB (Choline/Ethanolamine Kinase, Choline/Ethanolamine Kinase beta, CKEKB, Choline Kinase beta, CKB, CK, Choline Kinase-like Protein, Ethanolamine Kinase, Ethanolamine Kinase beta, CHETK, CHKL) (MaxLight 750) discontinued
124951-ML750 100 µL

CHKB (Choline/Ethanolamine Kinase, Choline/Ethanolamine Kinase beta, CKEKB, Choline Kinase beta, CKB, CK, Choline Kinase-like Protein, Ethanolamine Kinase, Ethanolamine Kinase beta, CHETK, CHKL) (MaxLight 750) discontinued

Sign In for Pricing
View Details