Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB6 Rabbit Polyclonal Antibody (Biotin)

HOXB6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HOX2, HU-2, HOX2B, Hox-2.2

UniProt

P17509

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCN

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061825

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse FCGR4 HEK293 Overexpression Lysate
MBS8116317-01 0.3 mg

Mouse FCGR4 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Mouse FCGR4 HEK293 Overexpression Lysate
MBS8116317-02 5x 0.3 mg

Mouse FCGR4 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
PRSS8 Rabbit mAb Antibody
orb3014950 100 µL

PRSS8 Rabbit mAb Antibody

Sign In for Pricing
View Details
IL22RA1 (Interleukin 22 Receptor, alpha 1, CRF2-9, IL22R, IL22R1) (MaxLight 550)
247570-ML550 100 µL

IL22RA1 (Interleukin 22 Receptor, alpha 1, CRF2-9, IL22R, IL22R1) (MaxLight 550)

Sign In for Pricing
View Details
9530077C05Rik 3'UTR Luciferase Stable Cell Line
TU101022 1.0 mL

9530077C05Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Proteus mirabilis Nucleoside diphosphate kinase (ndk)
MBS1135077-01 0.02 mg (E-Coli)

Recombinant Proteus mirabilis Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details