Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYF6 Rabbit Polyclonal Antibody (FITC)

MYF6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CNM3, MRF4, myf-6, bHLHc4

UniProt

P23409

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MYF6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_002460

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat c-MPL/CD110/TPOR Protein (His Tag)
PKSR030214 100 µg

Recombinant Rat c-MPL/CD110/TPOR Protein (His Tag)

Sign In for Pricing
View Details
LOC100361637 3'UTR Luciferase Stable Cell Line
TU208031 1.0 mL

LOC100361637 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PGA4, CT (Pepsin A, PGA3, ) (MaxLight 750) discontinued
039908-ML750 100 µL

PGA4, CT (Pepsin A, PGA3, ) (MaxLight 750) discontinued

Sign In for Pricing
View Details
HDAC1 Microplate Snapshot ChIP Assay
CP-0103S 16 Reactions

HDAC1 Microplate Snapshot ChIP Assay

Sign In for Pricing
View Details
KRR1 Rabbit pAb, Pacific Blue conjugated
orb2861777 100 µL

KRR1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Ptk7, Recombinant, Mouse, aa23-696, His-Tag (Inactive Tyrosine-protein Kinase 7)
374927-01 20 µg

Ptk7, Recombinant, Mouse, aa23-696, His-Tag (Inactive Tyrosine-protein Kinase 7)

Sign In for Pricing
View Details