Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYF6 Rabbit Polyclonal Antibody (HRP)

MYF6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CNM3, MRF4, myf-6, bHLHc4

UniProt

P23409

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MYF6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_002460

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

gamma-Hydroxy Phenylbutazone
TRC-H940070-25MG 25 mg

gamma-Hydroxy Phenylbutazone

Sign In for Pricing
View Details
MFluor™ UV375 Anti-human CD4 Antibody *SK3*
100420X0-AAT 100 Tests

MFluor™ UV375 Anti-human CD4 Antibody *SK3*

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR561476 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
ATP1A3 Human qPCR Primer Pair (NM_152296)
HP226352 200 Reactions

ATP1A3 Human qPCR Primer Pair (NM_152296)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS507616 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
CD61 (ITGB3) Rabbit Polyclonal Antibody
AP02622PU-N 100 µL

CD61 (ITGB3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details