Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYF6 Rabbit Polyclonal Antibody (Biotin)

MYF6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CNM3, MRF4, myf-6, bHLHc4

UniProt

P23409

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MYF6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_002460

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS15 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
42104156 3x 1.0 µg DNA

RPS15 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Rabbit Anti-HIV2 gp41 + gp160 antibody
SL10481R-01 50 µL

Rabbit Anti-HIV2 gp41 + gp160 antibody

Sign In for Pricing
View Details
Rabbit Anti-HIV2 gp41 + gp160 antibody
SL10481R-02 100 µL

Rabbit Anti-HIV2 gp41 + gp160 antibody

Sign In for Pricing
View Details
TFIIH basal Transcription Factor complex helicase XPB subunit (ERCC3) Chicken ELISA Kit
H5480 96 Tests

TFIIH basal Transcription Factor complex helicase XPB subunit (ERCC3) Chicken ELISA Kit

Sign In for Pricing
View Details
CJ119, NT (MCMBP, C10orf119, Mini-chromosome maintenance complex-binding protein) (MaxLight 490) discontinued
033923-ML490 100 µL

CJ119, NT (MCMBP, C10orf119, Mini-chromosome maintenance complex-binding protein) (MaxLight 490) discontinued

Sign In for Pricing
View Details
STING/TMEM173 polyclonal antibody
BS80431-01 50 µL

STING/TMEM173 polyclonal antibody

Sign In for Pricing
View Details