Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU1F1 Rabbit Polyclonal Antibody (FITC)

POU1F1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PIT1, CPHD1, GHF-1, Pit-1, POU1F1a

UniProt

P28069

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human POU1F1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDM

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000297

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UQCRC1 antibody
70R-10304 50 ug

UQCRC1 antibody

Sign In for Pricing
View Details
GCN5L2 (K(Lysine) Acetyltransferase 2A, GCN5, GCN5L2, MGC102791, PCAF-b, hGCN5) (MaxLight 650)
MBS6227740-01 0.1 mL

GCN5L2 (K(Lysine) Acetyltransferase 2A, GCN5, GCN5L2, MGC102791, PCAF-b, hGCN5) (MaxLight 650)

Sign In for Pricing
View Details
GCN5L2 (K(Lysine) Acetyltransferase 2A, GCN5, GCN5L2, MGC102791, PCAF-b, hGCN5) (MaxLight 650)
MBS6227740-02 5x 0.1 mL

GCN5L2 (K(Lysine) Acetyltransferase 2A, GCN5, GCN5L2, MGC102791, PCAF-b, hGCN5) (MaxLight 650)

Sign In for Pricing
View Details
Lentiviral human PRDX2 sgRNA gene knockout kit - Lentiviral human PRDX2 sgRNA gene knockout kit (plasmid)
GTR15393284 1 Vial

Lentiviral human PRDX2 sgRNA gene knockout kit - Lentiviral human PRDX2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Mmu-miR-1903 miRNA Mimic
orb1875572-01 5 nmol

Mmu-miR-1903 miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-1903 miRNA Mimic
orb1875572-02 10 nmol

Mmu-miR-1903 miRNA Mimic

Sign In for Pricing
View Details