Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF7 Rabbit Polyclonal Antibody (HRP)

TCF7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TCF-1

UniProt

P36402

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TCF7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MQLYPGWSARDNYGKKKRRSREKHQESTTETNWPRELKDGNGQESLSMSS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_963964

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
MBS2131184-01 0.1 mL

APC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)

Sign In for Pricing
View Details
APC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
MBS2131184-02 0.2 mL

APC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)

Sign In for Pricing
View Details
APC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
MBS2131184-03 0.5 mL

APC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)

Sign In for Pricing
View Details
APC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
MBS2131184-04 1 mL

APC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)

Sign In for Pricing
View Details
APC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
MBS2131184-05 5 mL

APC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)

Sign In for Pricing
View Details
APC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
MBS2131184-06 5x 5 mL

APC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)

Sign In for Pricing
View Details