Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF7 Rabbit Polyclonal Antibody (HRP)

TCF7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TCF-1

UniProt

P36402

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TCF7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTDNSLHYS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_998813

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human LY6H Antibody (12G7), PerCP
ARO-A10203-01 50 µg

Anti-Human LY6H Antibody (12G7), PerCP

Sign In for Pricing
View Details
Anti-Human LY6H Antibody (12G7), PerCP
ARO-A10203-02 100 µg

Anti-Human LY6H Antibody (12G7), PerCP

Sign In for Pricing
View Details
Anti-Human LY6H Antibody (12G7), PerCP
ARO-A10203-03 1 mg

Anti-Human LY6H Antibody (12G7), PerCP

Sign In for Pricing
View Details
BCAT1 Rabbit pAb, IRDye 800CW conjugated
orb2875175 100 µL

BCAT1 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
50 L Sinlge-Use Open bag -T
BIOBGBTLR0050S006 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

50 L Sinlge-Use Open bag -T

Sign In for Pricing
View Details
Interleukin 6 (IL-6, B cell Stimulatory Factor 2, BSF2, Cytotoxic T cell Differentiation Factor, CTL Differentiation Factor, CDF, Hepatocyte Stimulating Factor, HSF, Hybridoma Growth Factor, HGF, Hybridoma Plasmacytoma Growth Factor, HPGF, Interferon beta 2, IFNB2) (Azide Free) (MaxLight 405) discontinued
I8428-06B-ML405 100 µL

Interleukin 6 (IL-6, B cell Stimulatory Factor 2, BSF2, Cytotoxic T cell Differentiation Factor, CTL Differentiation Factor, CDF, Hepatocyte Stimulating Factor, HSF, Hybridoma Growth Factor, HGF, Hybridoma Plasmacytoma Growth Factor, HPGF, Interferon beta 2, IFNB2) (Azide Free) (MaxLight 405) discontinued

Sign In for Pricing
View Details