Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM6 Rabbit Polyclonal Antibody (FITC)

RBM6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

3G2, g16, DEF3, DEF-3, HLC-11, NY-LU-12

UniProt

P78332

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RBM6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RNRDVSDLDFRDKDGTQVDFRGRGSGTTDLDFRDRDTPHSDFRGRHRSRT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

129kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005768

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenine Hemisulfate
TRC-A280365-50G 50 g

Adenine Hemisulfate

Sign In for Pricing
View Details
U2SURP Antibody - N-terminal region : Biotin (ARP75469_P050-Biotin)
ARP75469_P050-Biotin 100 µL

U2SURP Antibody - N-terminal region : Biotin (ARP75469_P050-Biotin)

Sign In for Pricing
View Details
Rat Glyr1 Pre-designed siRNA Set B
SI205657B 1 Each

Rat Glyr1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
T-box Transcription Factor TBX5 (TBX5) Chicken ELISA Kit
H4259 96 Tests

T-box Transcription Factor TBX5 (TBX5) Chicken ELISA Kit

Sign In for Pricing
View Details
ACOT12 (CACH, CACH1, STARD15, Acyl-coenzyme A thioesterase 12, Acyl-CoA thioesterase 12, Acyl-CoA thioester hydrolase 12, Cytoplasmic acetyl-CoA hydrolase 1, CACH-1, hCACH-1, START domain-containing protein 15, StARD15)
304451-01 50 µg

ACOT12 (CACH, CACH1, STARD15, Acyl-coenzyme A thioesterase 12, Acyl-CoA thioesterase 12, Acyl-CoA thioester hydrolase 12, Cytoplasmic acetyl-CoA hydrolase 1, CACH-1, hCACH-1, START domain-containing protein 15, StARD15)

Sign In for Pricing
View Details
ACOT12 (CACH, CACH1, STARD15, Acyl-coenzyme A thioesterase 12, Acyl-CoA thioesterase 12, Acyl-CoA thioester hydrolase 12, Cytoplasmic acetyl-CoA hydrolase 1, CACH-1, hCACH-1, START domain-containing protein 15, StARD15)
304451-02 100 µg

ACOT12 (CACH, CACH1, STARD15, Acyl-coenzyme A thioesterase 12, Acyl-CoA thioesterase 12, Acyl-CoA thioester hydrolase 12, Cytoplasmic acetyl-CoA hydrolase 1, CACH-1, hCACH-1, START domain-containing protein 15, StARD15)

Sign In for Pricing
View Details